PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009631363.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 291aa    MW: 32621.9 Da    PI: 8.9919
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009631363.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA51.24.2e-16204239137
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkp 37 
                     d p+YVNaKQy++Il+RRq Rakle+++kl  k+rk 
  XP_009631363.1 204 DGPIYVNAKQYHGILRRRQIRAKLEAQNKL-VKARKD 239
                     57****************************.898885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.5E-10202253IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115217.535203238IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.9E-12206239IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860208228IPR018362CCAAT-binding factor, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MAIRAQALPN RSLEQTPTCF VPHFAVNNST WWSSNEVQSS QSLSKNLTSE VVFLPPPCQQ  60
MKFLGLELQG DDSHSTQSNS NPPLEVTAWG KTGSQDQCTS SGSDSLFAIS TGVRLRLVLL  120
FSVHDENYKR HKQAQIKPIS FIRNPEYTTD CSQSEMAHSI SHAPFGYSDP YLSGLYAAYG  180
PHVFPQMMGI APARLPLPLD LAEDGPIYVN AKQYHGILRR RQIRAKLEAQ NKLVKARKDT  240
NWGRQIDWRV SSHLLLTWEC MNPPKCTNFW RIRHAPNGIS KSPSNIDAVS S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631363.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X3
TrEMBLM0ZH803e-57M0ZH80_SOLTU; Uncharacterized protein
TrEMBLM0ZH828e-58M0ZH82_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000007407e-57(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34720.11e-17nuclear factor Y, subunit A4